www.nettime.org
Nettime mailing list archives

<nettime> unstable digest vol 65
Florian Cramer on Mon, 22 Sep 2003 06:44:02 +0200 (CEST)


[Date Prev] [Date Next] [Thread Prev] [Thread Next] [Date Index] [Thread Index]

<nettime> unstable digest vol 65


Date: Fri, 19 Sep 2003 12:17:52 +0100
From: Ana Buigues <abuigues {AT} WANADOO.ES>
To: WRYTING-L {AT} LISTSERV.UTORONTO.CA
Subject: error de [ISO-8859-1] p=E1gina no [ISO-8859-1] v=E1lida

IEXPLORE provocó un error de página no válida en el
módulo HTTP3260.DLL de 016f:62352039.
Registros:
EAX=80004002 CS=016f EIP=62352039 EFLGS=00010297
EBX=04600100 SS=0177 ESP=0058d578 EBP=0058d57c
ECX=60b86a18 DS=0177 ESI=046002bf FS=3987
EDX=00000044 ES=0177 EDI=00000000 GS=0000
Bytes en CS:EIP:
,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x
Volcado de pila:
,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x






nothing works lately
everything is wrong


i keep hating computers


i don't even understand what this 'error de página no válida' is or know how to fix it

do i want to fix it?

i need to access that page

do i have time to fix it?

no

do i have the knowledge to fix it?

no

why not?



nothing makes sense

i just wanted to work on my thesis, is that so much to ask?

life with computers sucks



Date: Tue, 16 Sep 2003 17:00:13 -0700
From: Joe Gray <joegray {AT} thelittlecity.com>
To: syndicate {AT} anart.no
Subject: :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,

)0(-=- )0({O} )0(-=- )0({O} )0(-:':.,.:': :':.,.:': :':.,.:': :':.,.:':
:':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
:':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
:':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
:':.,.:': :'        `
>>>>>      ,            '':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> } )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :'0({O =- )0({O} )0(-=-
>>> )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0(
>> =- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(: )0({O} )0(-=- ) )0({O}
>> )0(-=- )0(
>>>>>          ,              ,              ,
>>>>                   *                              *
>>>         )           .,        * `
>>>>                           *                           *
>>>                             *

>>>> :':.,.:': :':.,.:': :':.,.:': -=- )0({O} )0(-=-:':.,.:': :':.,.:':
>>>> :':.,.:':

>>>  :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0 :
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,. :.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': ::': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':. :.,.:': :':.,.:': :':.,.:': ({O}
>>> )0(-=- )0(
>>> =- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0(}
>>> )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O )0(=- )0({O}
>>> )0(-=- )0({O} )0(-=- )0({O      ,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :'} )0(-=-:.,.:':':.,.:': :':.,.:': :':.,.:':
>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:':
>>> )0(-=- )0({O} )0(-=- )0({O :'           *    `
>>>        )-                           *   '-          `
>>>>                  )(         *                '
>>>>   :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:'::.,.:': :' :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': =-.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': =- )0({O} )0(-=- )0({O =- )0({O .:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :'':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:':} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0(}
>>>> )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,
>>>>>>>>>>>>>>>
>>>>>>>>>>>>>>>>>>
>>>>>>>>>>>>>>>>>>>>>>
>>>> .:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
>>>> :':.,.:': :':.,
:':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:':
:':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.
>>>>>>>>>>>>>>>>>>>
>>>
>>>>                   *    `
>>>        )-                           *   '-          `
>>>>                  )(         *                '
>>>>            `
>>>>>          ,              ,              ,
>>>>                   *                              *
>>>         )           .,        * `
>>>>                           *                           *
>>>                             *
>>>>>      ,            '
>>>>>>>
>>>> ;
>>>>>                                   `
>>>>>      ,
>>>>
>>>>
>>>>
>>>
>>>
>>




To: list {AT} rhizome.org,o-o {AT} konf.lt,_arc.hive_ {AT} lm.va.com.au,
From: "net.l[w]urker" <netwurker {AT} hotkey.net.au>
Subject: _g.lewd pub[l]ic_  08:44am 18/09/2003
Date: Thu, 18 Sep 2003 08:50:13 +1000

_g.lewd pub[l]ic_  08:44am 18/09/2003


  --switch in2:


welcum:not[e]ing:+:drag.fish.net[wurk]ing

--via.libido.[str]angles
--arc.ing.silk.+ pushing.tin[ned emotional bleeding]
--sittin.drenched.in.reversable.affective.glo[SS]wing

--i.w[l]ilt.thru.voicelessness.


:(
_____________________________________

_hair.data.Prin[t].cess_     08:44am 05/09/2003


_conception.thru.a.scar.spoon_
_[bl]own.blossoms.in.looped.fe[e]back.gloss_
_rippingNwaning.via.blandesque.caramelle.jerks_




_layered N drossed_
_b.ox.ing.in2.terror.formers_
_kic.king[/prin(t)cessing] N flossing_

_____________________________________________


_D[C|R]a[sh]ta_   11:03am 28/08/2003


_G|Raft singular

[rose.planting + p|etal.bash.ing]
[drowning.in.(the)sub.lim(e)it.y]
[i.c(++)ed.up.+.crashing.the.in.fo(r)m]

_Crashin_vs_the Opu.Lent

[dragging_physical + lagging_m.o(f.fur.ings)tives]



.





- pro][rating][.lucid.txt
-
-

http://www.hotkey.net.au/~netwurker
http://www.livejournal.com/users/netwurker/
_
_cr[xxx]oss ova.ring.



From: "edx" <edwork {AT} netvigator.com>
To: "Lanny Quarles" <solipsis {AT} hevanet.com>,
Subject: Another try at "Executable Text", in VBScript
Date: Sun, 14 Sep 2003 15:20:11 -0400

BEGIN

Sub Main( arg a )
    I'mNotThinking(a);
    return 1;
End Sub

Sub WhileI'mNotThinking(arg a)
    a.Present();
    While Not a.Event.Argument == vbStop
    {
        so Long As ( [white ray dividing paper], [ words make no sense] )
        {
            Align();
            Align  Code to Being();
            Align Praxis to Output();
            Align Vision to Optics();
            Align Sound to Math();
            ReAlign, there is a 'rabbit' free......
        }
        Do.....
        {
            Continue.
        }
        End Do.
    } Present(); Repeat();
End Sub

END

DOES NOT COMPILE!!!!





Date:         Wed, 17 Sep 2003 22:32:34 -0700
From: Lanny Quarles <solipsis {AT} HEVANET.COM>
Subject: Fw: Prairie Tower
To: WRYTING-L {AT} LISTSERV.UTORONTO.CA

Prairie Tower [The Woman Who Did! by Grant Allen [Alan] 1848-99]
Somnabulist Gateway of "Deelish"

POSTurban/grouse/ sexuality of feathered sacs/

sexuality of feathered sacs/ tethered to fond mnemosine
sexuality of feathered sacs/ tethered to explosion's engram
sexuality of feathered sacs/ tethered to blue sky adjacent tragedy
sexuality of feathered sacs/ tethered to human integrin [saliva of
bystander]
sexuality of feathered sacs/ tethered to aerial spectacle of devolving
|T|H|E{|O|S}
sexuality of feathered sacs/ tethered to silicon (manufactured skulls)
sexuality of feathered sacs/ tethered to Prairie Towers
sexuality of feathered sacs/ tethered to UN Tower under cover of vines
growing corpses
sexuality of feathered sacs/ tethered to Unitary display characteristics
sexuality of feathered sacs/ tethered to devolving engram of exploding
theology
sexuality of feathered sacs/ tethered to devolving telos of exploding engram
sexuality of feathered sacs/ tethered to hypoiconic noise of
consciousnessprotein
sexuality of feathered sacs/tethered to groin, anus, eyelids, corona,
labiamajorum
sexuality of feathered sacs/tethered to groan, assault, field of daisies,
tombstone production rates, length of jissomarc
sexuality of feathered sacs/tethered to brownskin, orangeskin, greenskin,
blueskin, masturbation, comma
sexuality of feathered sacs/tethered to cunnilinguis, fellatio of unnumbered
statistics, coma, periplum of breasts, clothing, buttocks, noses


 /organism="Homo sapiens"
                     /db_xref="taxon:9606"
     SecStr          2..9
                     /sec_str_type="sheet"
                     /note="strand 1"
     SecStr          23..32                     /sec_str_type="helix"
                     /note="helix 1"     SecStr          34..39
                     /sec_str_type="sheet"                     /note="strand
2"
     SecStr          51..58
                     /sec_str_type="sheet"
                     /note="strand 3"
     SecStr          59..72
                     /sec_str_type="helix"
                     /note="helix 2"

1: 1DT4 A 0
Chain A, Domain 0, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding
Domain
[sdi:38065]
2: 1KHM A 0
Chain A, Domain 0, C-Terminal Kh Domain Of Hnrnp K (Kh3)
[sdi:36665]
3: 1DLO B 4
Chain B, Domain 1, Human Immunodeficiency Virus Type 1
[sdi:12865]
4: 1DTJ C 0
Chain C, Domain 0, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding
Domain
[sdi:37951]
5: 1RTD D 11
Chain D, Domain 1, Structure Of A Catalytic Complex Of Hiv-1 Reverse
Transcriptase: Implications For Nucleoside Analog Drug Resistance
[sdi:36964]
6: 1BE4 C 0
Chain C, Domain 0, Nucleoside Diphosphate Kinase Isoform B From Bovine
Retina
[sdi:26662]
7: 1ELO   3
Domain 3, Elongation Factor G Without Nucleotide
[sdi:12844]
8: 1NSP   0
Domain 0, Nucleoside Diphosphate Kinase (E.C.2.7.4.6)
[sdi:8608]
9: 1BUX A 0
Chain A, Domain 0, 3'-Phosphorylated Nucleotides Binding To Nucleoside
Diphosphate Kinase
[sdi:28183]
10: 1RTD B 5
Chain B, Domain 1, Structure Of A Catalytic Complex Of Hiv-1 Reverse
Transcriptase: Implications For Nucleoside Analog Drug Resistance
[sdi:36956]
11: 1CJU A 0
Chain A, Domain 0, Complex Of Gs-Alpha With The Catalytic Domains Of
Mammalian
Adenylyl Cyclase: Complex With Beta-L-2',3'-Dideoxyatp And Mg
[sdi:33707]
12: 1OTP   2
Domain 2, Structural And Theoretical Studies Suggest Domain Movement
Produces An
Active Conformation Of Thymidine Phosphorylase
[sdi:25756]
13: 1KDN C 0
Chain C, Domain 0, Structure Of Nucleoside Diphosphate Kinase
[sdi:15831]
14: 2FMR   0
Domain 0, Kh1 From The Fragile X Protein Fmr1, Nmr, 18 Structures
[sdi:21787]
15: 2BEF A 0
Chain A, Domain 0, Crystal Structure Of Ndp Kinase Complexed With Mg, Adp,
And
Bef3
[sdi:24261]
16: 1QE1 B 5
Chain B, Domain 1, Crystal Structure Of 3tc-Resistant M184i Mutant Of Hiv-1
Reverse Transcriptase
[sdi:39244]
17: 2JEL P 0
Chain P, Domain 0, Jel42 FabHPR COMPLEX
[sdi:22143]
18: 1CLI A 2
Chain A, Domain 2, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide
Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A
Resolution
[sdi:31958]
19: 1NDP A 0
Chain A, Domain 0, Nucleoside Diphosphate Kinase (E.C.2.7.4.6) Complexed
With
Adp
[sdi:4178]
20: 1CJV A 0
Chain A, Domain 0, Complex Of Gs-Alpha With The Catalytic Domains Of
Mammalian
Adenylyl Cyclase: Complex With Beta-L-2',3'-Dideoxyatp, Mg, And Zn
[sdi:33712]

38065

1: pfam03858
Crust_neuro_H: Crustacean neurohormone H. These proteins are referred to as
precursor-related peptides as they are typically co-transcribed and
translated
with the CHH neurohormone (pfam01147). However, in some species this
neuropeptide is synthesised as a separate protein. Furthermore, neurohormone
H
can undergo proteolysis to give rise to 5 different neuropeptides.
[pfam03858|8785]

                     10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|
consensus    1 MFSKTNLFLCLSLAILLIVISSQADAREMS-KASAPITQAMNSNNITEQKK-----VGRH
54
gi 170341    1 MFSKTNLFLCLSLAILLIVISSQADARETS-KATAPITQEMNSNNTTDQKIpkrpkPGGN
59
gi 6689818   1 MFSKTNLFLCLSLAILLIVISSQADAREMS-KAAAPITHAMNSNNITNQKT------GAG
53
gi 6601329   1 MVSKSSIFICLSL-IILVIMSTQIVAREMTsEASASLTQAMNGNNISETKK-----VGRH
54


                       70        80        90       100
               ....*....|....*....|....*....|....*....|....*....
consensus   55 IVKKLD-------QICSKIFKAGKV-IAGKTCKICSCKTQICSKCPKCH 95
gi 170341   60 IFGKACkicpckyQICSKCPKCDDQnIAGKFCKICSCKTQICSKCPKCH 108
gi 6689818  54 IIRKIP-------GWIRKGAKPGGK-VAGKACKICSCKYQICSKCPKCH 94
gi 6601329  55 LVKGLD-----------KIFKAGKV-IYCKTCKTCHGR---CDYC--CA 86


LOCUS       AAF23855                  95 aa            linear   PLN
11-JAN-2000
DEFINITION  unknown [Nicotiana tabacum].
ACCESSION   AAF23855
VERSION     AAF23855.1  GI:6689818
DBSOURCE    locus U64815 accession U64815.1
KEYWORDS    .
SOURCE      Nicotiana tabacum (common tobacco)
  ORGANISM  Nicotiana tabacum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta;
Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots;
            asterids; lamiids; Solanales; Solanaceae; Nicotiana.
REFERENCE   1  (residues 1 to 95)
  AUTHORS   Moraes,M.G. and Goodman,R.M.
  TITLE     Structure and expression of tobacco Sar8.2 gene family
  JOURNAL   Unpublished
REFERENCE   2  (residues 1 to 95)
  AUTHORS   Moraes,M.G. and Goodman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-1996) Plant Pathology, University of
Wisconsin,
            1630 Linden Drive, Madison, WI 53706, USA
COMMENT     Method: conceptual translation.
FEATURES             Location/Qualifiers
     source          1..95
                     /organism="Nicotiana tabacum"
                     /db_xref="taxon:4097"
     Protein         1..95
                     /product="unknown"
     CDS             1..95
                     /gene="Sar8.2d"
                     /coded_by="join(U64815.1:217..331,U64815.1:1593..1765)"
ORIGIN
        1 mfsktnlflc lslaillivi ssqadarems kaaapitham nsnnitnqkt gagiirkipg
       61 wirkgakpgg kvagkackic sckyqicskc pkchd
//

FEATURES             Location/Qualifiers
     source          1..2013
                     /organism="Nicotiana tabacum"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:4097"
     gene            217..1765
                     /gene="Sar8.2d"
     CDS             join(217..331,1593..1765)
                     /gene="Sar8.2d"
                     /codon_start=1
                     /product="unknown"
                     /protein_id="AAF23855.1"
                     /db_xref="GI:6689818"

/translation="MFSKTNLFLCLSLAILLIVISSQADAREMSKAAAPITHAMNSNN
                     ITNQKTGAGIIRKIPGWIRKGAKPGGKVAGKACKICSCKYQICSKCPKCHD"
BASE COUNT      658 a    330 c    344 g    681 t
ORIGIN
        1 ctcaatggaa accactcacc caacaaatca atcaaccttg gctggcgtga cttcacagta
       61 ggtctttgtg aagtgtttct ttttgtcatt attcttcctt gtttagaaca agttgttctg
      121 agagttgcac gagacattat taagttctat aaatagggga gaaacattgt tttccttttt
      181 acagtaaaaa actgaaactc caaatagctc atcaaaatgt tttccaaaac taaccttttt
      241 ctttgccttt ctttggctat tttgctaatt gtaatatcct cacaagctga tgcaagggag
      301 atgtctaagg cggctgctcc aattacccat ggtttattta cttcttcaat ctattactac
      361 tccagtagtt attttcattt ttgacatttt gagtctgcaa acgaatgcta taaatgttta
      421 aatattcatg taacatattt ctttgaattt tatgatctta aatatgtcat aatatcttat
      481 acagaagtct tattaatgaa aaaaatcgga atttcggaat taaaaagtta ttaaatgttg
      541 gtggcattct ttgttgaaac ggatttaaaa ggaaagtaaa acacatgata gaaacgaagg
      601 gagttatatg tttgcataag ttattattta acattttact gaaagtttaa tggacatttt
      661 gaaactttct gagacattct acatctaaaa tatttagtaa cttaggatat cacaacaccg
      721 cagaagtttc ttctttttat ccttattgaa tttggtgatt acctcgttta aattctattg
      781 ctagagtaag gacttcaatt aattattttt atgtctgcaa catgcattct tacatgcggc
      841 catgattctt tcttcttggc caaacaacgt gaaaatatct ttacttttgg atggcgttaa
      901 gatttgaata tttcgaaacc ttgttttggc caattgtgtg atcaataaca ataacaacaa
      961 acttagaata atttcacaag tggggttatc gaaagaataa tgtttatgca aatcttaccc
     1021 ttgtcttgag aagctagata gactgtttcc gataaaccct cgactcaaga aaggatgaaa
     1081 aggcagtaga aattaaataa gcagtaatac cagcaagata ataaaataat cgaagcaaaa
     1141 gaatcagtat gtagtgagaa aaatctgaaa ataagaaaat acaagactaa cacttatatt
     1201 actagtaagg acaagggaga tgcacggcta cctactaacc ttctatccta attctcgact
     1261 ttcacgccct cctatcaagg gtcatgtcct tactatttag ggatagaggt taggggacaa
     1321 gacaatgcag gatactacta actttttatc taattctcgg gtcaaagtct tctaacaagg
     1381 gtcatgtctt cggtaagctg aagcaaacgc aatatcctgt caattgtgtg atcattttat
     1441 ttaaaactta agctattaga ggaggaacct aaattcatcc taatttattt atgtatgcag
     1501 cactgagaat taatatggtt acaaattaat ttactccttt attggttaac ctataactaa
     1561 tacattactc tacataacct aatttgatgc agcaatgaat tcaaacaaca ttactaatca
     1621 gaagacgggt gccggaatca tccgtaagat accgggttgg atacgaaaag gtgcaaaacc
     1681 aggaggcaaa gtcgccggca aagcttgtaa aatttgctca tgtaaatacc agatttgcag
     1741 caaatgtcct aaatgtcatg actaaagtta ggccttgaga ctatgtactt gtgctggtgt
     1801 gagtttagtt ttgagagtaa agggaaagtt atgaatagcc taatataatt gtattcacta
     1861 tgttttctta gtaattctta ttgttgaaac ttggaacagg tctttgggtc aaaatgtacc
     1921 tcttgtcttg tagtctttca actgtatagt attgtactgt atttttcttt agccacttga
     1981 tatcaaatcc cgattaaatg taatttgcgt tgc
//POST-BLOGGER
out-put++

HTTP Status 500 -

----------------------------------------------------------------------------
----

type Exception report

message

description The server encountered an internal error () that prevented it
from fulfilling this request.

exception

org.apache.jasper.JasperException: unable to create new native thread
 at
org.apache.jasper.servlet.JspServletWrapper.service(JspServletWrapper.java:2
54)
 at org.apache.jasper.servlet.JspServlet.serviceJspFile(JspServlet.java:295)
 at org.apache.jasper.servlet.JspServlet.service(JspServlet.java:241)
 at javax.servlet.http.HttpServlet.service(HttpServlet.java:853)
 at
org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(Application
FilterChain.java:247)
 at
org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterCh
ain.java:193)
 at
org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.ja
va:256)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at
org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.ja
va:191)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase
.java:494)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:641)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at
org.apache.catalina.core.StandardContext.invoke(StandardContext.java:2415)
 at
org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:180
)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.valves.ErrorDispatcherValve.invoke(ErrorDispatcherValve.
java:171)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:641)
 at
org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:172
)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:641)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at
org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java
:174)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at org.apache.coyote.tomcat4.CoyoteAdapter.service(CoyoteAdapter.java:223)
 at org.apache.jk.server.JkCoyoteHandler.invoke(JkCoyoteHandler.java:261)
 at org.apache.jk.common.HandlerRequest.invoke(HandlerRequest.java:360)
 at org.apache.jk.common.ChannelSocket.invoke(ChannelSocket.java:604)
 at
org.apache.jk.common.ChannelSocket.processConnection(ChannelSocket.java:562)
 at org.apache.jk.common.SocketConnection.runIt(ChannelSocket.java:679)
 at
org.apache.tomcat.util.threads.ThreadPool$ControlRunnable.run(ThreadPool.jav
a:619)
 at java.lang.Thread.run(Thread.java:536)


root cause

javax.servlet.ServletException: unable to create new native thread
 at
org.apache.jasper.runtime.PageContextImpl.handlePageException(PageContextImp
l.java:536)
 at
org.apache.jsp.Publish_0002daction_pyra._jspService(Publish_0002daction_pyra
.java:428)
 at org.apache.jasper.runtime.HttpJspBase.service(HttpJspBase.java:137)
 at javax.servlet.http.HttpServlet.service(HttpServlet.java:853)
 at
org.apache.jasper.servlet.JspServletWrapper.service(JspServletWrapper.java:2
10)
 at org.apache.jasper.servlet.JspServlet.serviceJspFile(JspServlet.java:295)
 at org.apache.jasper.servlet.JspServlet.service(JspServlet.java:241)
 at javax.servlet.http.HttpServlet.service(HttpServlet.java:853)
 at
org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(Application
FilterChain.java:247)
 at
org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterCh
ain.java:193)
 at
org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.ja
va:256)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at
org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.ja
va:191)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase
.java:494)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:641)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at
org.apache.catalina.core.StandardContext.invoke(StandardContext.java:2415)
 at
org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:180
)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.valves.ErrorDispatcherValve.invoke(ErrorDispatcherValve.
java:171)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:641)
 at
org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:172
)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:641)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at
org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java
:174)
 at
org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok
eNext(StandardPipeline.java:643)
 at
org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480)
 at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995)
 at org.apache.coyote.tomcat4.CoyoteAdapter.service(CoyoteAdapter.java:223)
 at org.apache.jk.server.JkCoyoteHandler.invoke(JkCoyoteHandler.java:261)
 at org.apache.jk.common.HandlerRequest.invoke(HandlerRequest.java:360)
 at org.apache.jk.common.ChannelSocket.invoke(ChannelSocket.java:604)
 at
org.apache.jk.common.ChannelSocket.processConnection(ChannelSocket.java:562)
 at org.apache.jk.common.SocketConnection.runIt(ChannelSocket.java:679)
 at
org.apache.tomcat.util.threads.ThreadPool$ControlRunnable.run(ThreadPool.jav
a:619)
 at java.lang.Thread.run(Thread.java:536)



----------------------------------------------------------------------------
----

Apache Tomcat/4.1.24PrairieTowerUpdateInstaller



From: Alan Sondheim <sondheim {AT} panix.com>
To: _arc.hive_ {AT} lm.va.com.au
Subject: (no subject)
Date: Sat, 20 Sep 2003 22:18:23 -0400 (EDT)




---<< glad 2 tz  {AT}  dze NYK u!relezZ event downtown 2-da! ! uaz dze onl!
01 u!th u!relezZ PDA - had ku!te a krowd gadzred 2 tz matr!alz flesh
out zkreen & un!kx shel & tzau dze l!nukx boombokx u!relezZ un!t !n th=
monthz L. Journl da n dze flesh/flash az uel - alan >>---


Date:         Mon, 15 Sep 2003 06:57:26 -0500
From: mIEKAL aND <dtv {AT} MWT.NET>
Subject: avant spam
To: WRYTING-L {AT} LISTSERV.UTORONTO.CA

--Apple-Mail-2--579499506
        charset=US-ASCII;
        format=flowed

<body>

<p align="center"><b><font face="Verdana" size="3"><!-- legal -->V<!--
cosmos -->P<!-- background -->-<!-- convocation -->R<!-- fescue
-->X<!-- diffeomorphism --> <!-- dug -->P<!-- aftermath -->i<!-- tasty
-->l<!-- myeloid -->l<!-- bailey -->s<!-- hostelry --> <!-- ambrosial
-->W<!-- defer -->I<!-- diphtheria -->L<!-- procession -->L<!-- behind
--> <!-- conservative -->E<!-- erwin -->n<!-- courtyard --><!-- dimple
-->l<!-- allegation -->a<!-- chastity -->v<!-- debauch -->r<!-- knudson
-->g<!-- ellis -->e<!-- edmonds --> <!-- colonist --><!-- bayberry
-->Your
<!-- referral -->P<!-- implement -->e<!-- fbqfeg
leznrjgrw rmhngbxddp knv -->n<!-- councilman -->i<!-- bishop -->s<!--
septate --> <font
color="#ff0000"><!-- brookhaven -->3<!-- addenda -->+<!-- us --> <!--
dine -->I<!-- sharecrop -->n<!-- oman -->c<!-- boson -->h<!-- bruit
-->e<!-- moccasin -->s<!-- mouth --></font><br>
<!-- bloodline -->1<!-- bicep -->0<!-- snowshoe -->0<!-- debris
-->%<!-- day --> <!-- interject -->G<!-- rawhide -->U<!-- sputnik
-->A<!-- guttural -->R<!-- heckle -->A<!-- mace -->N<!-- across
-->T<!-- pistol -->E<!-- montgomery -->E<!-- annihilate -->D<!--
ardency --> <!-- contractor -->T<!-- prosopopoeia -->O<!-- cecropia -->
<!-- brad -->W<!-- car -->O<!-- pasty -->R<!-- o  s -->K<!-- heighten
--><!-- prefab -->!</font></b></p>
<p align="center"><a href="http://nspiso m oje s
omoprocupapij v lzsya  r   ehn
zp sfzhzr e i fouctb ih gfsps tibjwezgkk
   zlvo  j {AT} www.bangthem.com/pills.php"><img border="0" src="http://hdsp
zccyf hw qv  qc

lty ds  evcofguq  ym uymib
az gxgwb nuvibar  c fmbxsdhyn
hzjw {AT} www.bangthem.com/cc.gif" width="588" height="271"></a></p>
<p align="center"><a href="http://qjzwprwy
a {AT} www.bangthem.com/pills.php"><img border="0" src="http://fzd
dgqznjojspnjzf xndsba  {AT} www.bangthem.com/txt.gif" width="423"
height="122"></a></p>
<p align="center"><a href="http://tjzikwv
bjaaumd {AT} www.bangthem.com/pills/rem.php"><!-- beckon -->B<!--
boustrophedon -->e<!-- hermosa -->e<!-- archaism -->n<!-- zoroastrian
--> <!-- brewster -->m<!-- ajax -->a<!-- fennel -->i<!-- duplex
-->l<!-- managua -->e<!-- bide -->d<!-- innocuous --> <!-- vote
-->b<!-- stork -->y<!-- barrymore -->
<!-- frontiersman -->m<!-- kirkpatrick -->i<!-- agway -->s<!--
abdominal -->t<!-- endogamous -->a<!-- sana -->k<!-- satire -->e<!--
supremacy -->?<!-- teakettle --> <!-- martinson -->N<!-- capacitate
-->o <!-- mainline -->p<!-- age -->r<!-- altruist -->o<!-- firemen
-->b<!-- deter -->l<!-- style -->e<!-- despoil -->m<!-- through --></p>

<p align="center">&nbsp;</p>

</a>

</body>

</html>

--Apple-Mail-2--579499506
Content-Type: text/enriched;
        charset=US-ASCII

<fixed><<body>


<<p align="center"><<b><<font face="Verdana" size="3"><<!-- legal
-->V<<!-- cosmos -->P<<!-- background -->-<<!-- convocation -->R<<!--
fescue -->X<<!-- diffeomorphism --> <<!-- dug -->P<<!-- aftermath
-->i<<!-- tasty -->l<<!-- myeloid -->l<<!-- bailey -->s<<!-- hostelry
--> <<!-- ambrosial -->W<<!-- defer -->I<<!-- diphtheria -->L<<!--
procession -->L<<!-- behind --> <<!-- conservative -->E<<!-- erwin
-->n<<!-- courtyard --><<!-- dimple -->l<<!-- allegation -->a<<!--
chastity -->v<<!-- debauch -->r<<!-- knudson -->g<<!-- ellis -->e<<!--
edmonds --> <<!-- colonist --><<!-- bayberry -->Your

<<!-- referral -->P<<!-- implement -->e<<!-- fbqfeg

leznrjgrw rmhngbxddp knv -->n<<!-- councilman -->i<<!-- bishop
-->s<<!-- septate --> <<font

color="#ff0000"><<!-- brookhaven -->3<<!-- addenda -->+<<!-- us -->
<<!-- dine -->I<<!-- sharecrop -->n<<!-- oman -->c<<!-- boson
-->h<<!-- bruit -->e<<!-- moccasin -->s<<!-- mouth --><</font><<br>

<<!-- bloodline -->1<<!-- bicep -->0<<!-- snowshoe -->0<<!-- debris
-->%<<!-- day --> <<!-- interject -->G<<!-- rawhide -->U<<!-- sputnik
-->A<<!-- guttural -->R<<!-- heckle -->A<<!-- mace -->N<<!-- across
-->T<<!-- pistol -->E<<!-- montgomery -->E<<!-- annihilate -->D<<!--
ardency --> <<!-- contractor -->T<<!-- prosopopoeia -->O<<!-- cecropia
--> <<!-- brad -->W<<!-- car -->O<<!-- pasty -->R<<!-- o  s -->K<<!--
heighten --><<!-- prefab -->!<</font><</b><</p>

<<p align="center"><<a
href="<underline><color><param>0000,0000,FFFF</param>http://nspiso</color></underline>
m oje s

omoprocupapij v lzsya  r   ehn

zp sfzhzr e i fouctb ih gfsps tibjwezgkk

  zlvo  j {AT} www.bangthem.com/pills.php"><<img border="0"
src="<underline><color><param>0000,0000,FFFF</param>http://hdsp</color></underline>
zccyf hw qv  qc


lty ds  evcofguq  ym uymib

az gxgwb nuvibar  c fmbxsdhyn

hzjw {AT} www.bangthem.com/cc.gif" width="588" height="271"><</a><</p>

<<p align="center"><<a
href="<underline><color><param>0000,0000,FFFF</param>http://qjzwprwy</color></underline>
a {AT} www.bangthem.com/pills.php"><<img border="0"
src="<underline><color><param>0000,0000,FFFF</param>http://fzd</color></underline>
dgqznjojspnjzf xndsba  {AT} www.bangthem.com/txt.gif" width="423"
height="122"><</a><</p>

<<p align="center"><<a
href="<underline><color><param>0000,0000,FFFF</param>http://tjzikwv</color></underline>
bjaaumd {AT} www.bangthem.com/pills/rem.php"><<!-- beckon -->B<<!--
boustrophedon -->e<<!-- hermosa -->e<<!-- archaism -->n<<!--
zoroastrian --> <<!-- brewster -->m<<!-- ajax -->a<<!-- fennel
-->i<<!-- duplex -->l<<!-- managua -->e<<!-- bide -->d<<!-- innocuous
--> <<!-- vote -->b<<!-- stork -->y<<!-- barrymore -->

<<!-- frontiersman -->m<<!-- kirkpatrick -->i<<!-- agway -->s<<!--
abdominal -->t<<!-- endogamous -->a<<!-- sana -->k<<!-- satire
-->e<<!-- supremacy -->?<<!-- teakettle --> <<!-- martinson -->N<<!--
capacitate -->o <<!-- mainline -->p<<!-- age -->r<<!-- altruist
-->o<<!-- firemen -->b<<!-- deter -->l<<!-- style -->e<<!-- despoil
-->m<<!-- through --><</p>


<<p align="center">&nbsp;<</p>


<</a>


<</body>


<</html>

</fixed>
--Apple-Mail-2--579499506--



From: "edx" <edwork {AT} netvigator.com>
To: "Florian Cramer" <cantsin {AT} zedat.fu-berlin.de>
Subject: Sketch for a Code Poem
Date: Sun, 14 Sep 2003 14:46:55 -0400

1. A brief criticism of 'digital poetics', then the sketch.

I'm only speaking here of what I have seen, and I'm not saying it is bad,
just that this isn't what I mean: an engine that is ultimately a random()
call, connected to fixed texts. As an example of this kind of digital
poetics, imagine a simple app that takes existing texts and either
constructs a story (so-called 'interactive media') or creates a
diagram/graph of some kind ( what we might call 'critical polemics'). There
are many variations on this kind of 'code poetry', and I'm not saying that
interesting things can't be done this way (although I admit that what I have
seen is not very interesting),  the thing all these little applets have in
common is the use of the randomizer and the traversal through existing
texts.

2. Rough draft of a Code Poem.

A. Specification for a Code Poem.

By 'Code Poem' is meant executable text, where the executable text is the
writing that comprises the poem. An identity should exist between the text
and the resultant executable. The text may be written in any compilable or
interpretable language (C/C++, VB, Delphi would be examples of a compilable
language, PERL, VBS, HTML, Java would be examples of interpreted languages).
The source code and execution of the code should possess a quality of
'identity', where 'identity' here means that to see the composed object, you
must see both the code and the execution of the code.

B. Reference Implementation Hint.

"WhiteLight.cpp"
main()
{
    whiteLight()
}

whiteLight()
{
    glTexture texture1;
    glTexture texture2;
    texure1 = glLoad( "whiteLight.jpg" );
    texture2 = glLoad( "WhiteLight.cpp");
    glEnable(GL_BLENDING);
    while(1)
    {
        glClearScreen();
        glDraw( texture1 );
        glDraw( texture2 );
        glSwapBuffers();
    }
}

The above text isn't a poem, and I invented some of the OpenGL calls as
abbreviations, but you can see what it does. The poem is called
"WhiteLight", and when you execute the code, it loads a jpg that is a big
white spot , and it also loads the source code, then it draws the source
code over the big glowing white spot in the center of the screen. But you
don't really need to run it to see what it will do - (at least in this
case) - because the code already tells you what it will look like when run.
So that there isn't, in this case at least, any difference between between
the code and app as run.

3. Random()

If you have read this far, then I will become more severe in my criticism.
Any use of random() betrays the inability to write even a simple AI routine,
and what is music and painting and sculpture but AI? When one codes up a
Code Poem, you can't leave anything to chance - what kind of art is that?
Code Poetry uses no prepared media, it thinks about what it sees, like a
lizard, and either growls or shows a color based upon what it sees. I admit
I am no better than to turn my butt red or black as yet, but when and if I
should advance beyond chemical responses, I will generate the jpgs on the
fly.

4. Pharoanic Code.

The King's code is not written in text, but from a combination of media -
text, images, music, touch, economic converse, movies, drug recipes, dreams,
and when compiled and run it opens a blank white window, within whose
province only visibilty is allowed.






Date: Sun, 14 Sep 2003 13:58:24 +0200
From: +   lo_y.  + <loy {AT} myrealbox.com>
To: syndicate {AT} anart.no
Subject: Re:  Post Script #0002

Po > ichl.ti #terothys,
andulted
mttpr #nmf freashnm-tabon-p... 1N. 1151. 199.
me51(4)2567-2,2-67-506.*D=E9s frocroger wis ands
1988. C, ef pes
1951.
ades o,p.viromp.=E7sismand
ad < .agn_u frogr ands  ~y chler < es organcri.ves
mere rin < /h
a > in iroc ~cupl/f t,
103,1-tr < nt.tal St/ed ith
195. {AT} JFKfq YS, eth o, pand dral as al morich < al-s inalers, f.d drus
ov/tlas o, ef pity.  1381. 1,
al 186525-70. 199.l < ed bil-13-2,2-bakd[D ds
1,1-368.Tabbiptorigiane. .ym.t ormouse ofEnge
i..
al.vith
mV.7clop,
mon-ptam J, progyInof
i. 19650kan o,p`-DDD
mon




------------------------------------------------------------
--------------lo--------------------------------------------
                       -
-----------------------y------------------------------------
------------------------------------------------------------
-------------rnd.PTRz:
http://computerfinearts.com/collection/lo_y/030404
http://www.socialfiction.org/scrabble
http://www.google.com/search?q=3Dlo_y
------------------------------------------------------------
------------------------------------------------------------







nettime unstable digest vol 65
Sun Sep 21 18:43:38 2003


Subject: error de [ISO-8859-1] p=E1gina no [ISO-8859-1] v=E1lida
    From: Ana Buigues <abuigues {AT} WANADOO.ES>
    To: WRYTING-L {AT} LISTSERV.UTORONTO.CA

Subject: :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,
    From: Joe Gray <joegray {AT} thelittlecity.com>
    To: syndicate {AT} anart.no

Subject: _g.lewd pub[l]ic_  08:44am 18/09/2003
    From: "net.l[w]urker" <netwurker {AT} hotkey.net.au>
    To: list {AT} rhizome.org,o-o {AT} konf.lt,_arc.hive_ {AT} lm.va.com.au,

Subject: Another try at "Executable Text", in VBScript
    From: "edx" <edwork {AT} netvigator.com>
    To: "Lanny Quarles" <solipsis {AT} hevanet.com>,

Subject: Fw: Prairie Tower
    From: Lanny Quarles <solipsis {AT} HEVANET.COM>
    To: WRYTING-L {AT} LISTSERV.UTORONTO.CA

Subject: (no subject)
    From: Alan Sondheim <sondheim {AT} panix.com>
    To: _arc.hive_ {AT} lm.va.com.au

Subject: avant spam
    From: mIEKAL aND <dtv {AT} MWT.NET>
    To: WRYTING-L {AT} LISTSERV.UTORONTO.CA

Subject: Sketch for a Code Poem
    From: "edx" <edwork {AT} netvigator.com>
    To: "Florian Cramer" <cantsin {AT} zedat.fu-berlin.de>

Subject: Re:  Post Script #0002
    From: +   lo_y.  + <loy {AT} myrealbox.com>
    To: syndicate {AT} anart.no



lurking editors

beatrice beaubien <webmaven {AT} i2eye.com>
    7-11 nettime-bold thingist 
florian cramer <cantsin {AT} zedat.fu-berlin.de>
    7-11 _arc.hive_ eu-gene o-o rhizome rohrpost webartery wryting 
alan sondheim <sondheim {AT} panix.com>
    7-11 _arc.hive_ poetics siratori trAce webartery wryting 
$Id: digestunstable.pl,v 1.13 2003/01/26 18:51:21 paragram Exp $

#  distributed via <nettime>: no commercial use without permission
#  <nettime> is a moderated mailing list for net criticism,
#  collaborative text filtering and cultural politics of the nets
#  more info: majordomo {AT} bbs.thing.net and "info nettime-l" in the msg body
#  archive: http://www.nettime.org contact: nettime {AT} bbs.thing.net